View larger
Rat Cx3cl1 (O55145, 25 a.a. - 100 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P9455
New product
Cx3cl1 (Rat) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | Cx3cl1 |
| Gene Alias | Cx3c|Scyd1 |
| Gene Description | chemokine (C-X3-C motif) ligand 1 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | QHLGMTKCNITCHKMTSPIPVTLLIHYQLNQESCGKRAIILETRQHRHFCADPKEKWVQDAMKHLDHQTAALTRNG |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | Lyophilized from sterile distilled Water is > |
| Gene ID | 89808 |
More info
Rat Cx3cl1 (O55145, 25 a.a. - 100 a.a.) partial recombinant protein expressed in Escherichia coli.