Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
CX3CL1 (Human) Recombinant Protein
Abnova
CX3CL1 (Human) Recombinant Protein
Ref: AB-P9452
CX3CL1 (Human) Recombinant Protein
Contacte-nos
Información del producto
Human CX3CL1 (P78423, 25 a.a. - 100 a.a.) partial recombinant protein expressed in
Escherichia coli
.
Información adicional
Size
20 ug
Gene Name
CX3CL1
Gene Alias
ABCD-3|C3Xkine|CXC3|CXC3C|NTN|NTT|SCYD1|fractalkine|neurotactin
Gene Description
chemokine (C-X3-C motif) ligand 1
Storage Conditions
Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key
Func,SDS-PAGE
Immunogen Prot. Seq
QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG
Form
Lyophilized
Recomended Dilution
Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer
Lyophilized from sterile distilled Water is >
Gene ID
6376
Enviar uma mensagem
CX3CL1 (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*