TAFA5 (Human) Recombinant Protein
  • TAFA5 (Human) Recombinant Protein

TAFA5 (Human) Recombinant Protein

Ref: AB-P9451
TAFA5 (Human) Recombinant Protein

Información del producto

Human TAFA5 (Q7Z5A7, 26 a.a. - 125 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name FAM19A5
Gene Alias QLLK5208|TAFA-5|TAFA5|UNQ5208
Gene Description family with sequence similarity 19 (chemokine (C-C motif)-like), member A5
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MKHHHHHHASQFLKEGQLAAGTCEIVTLDRDSSQPRRTIARQTARCACRKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCTQPGGRIKTTTVS
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris buffer pH 7.5 (50mM NaCl,10% (w/v) glycerol)
Gene ID 25817

Enviar uma mensagem


TAFA5 (Human) Recombinant Protein

TAFA5 (Human) Recombinant Protein