Ccl21a (Mouse) Recombinant Protein
  • Ccl21a (Mouse) Recombinant Protein

Ccl21a (Mouse) Recombinant Protein

Ref: AB-P9450
Ccl21a (Mouse) Recombinant Protein

Información del producto

Mouse Ccl21a (P84444, 24 a.a. - 133 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 2 x 10 ug
Gene Name Ccl21a
Gene Alias 6CKBAC2|6Ckine|ALP|AW987545|CKb9|MGC107632|SCYA21a|SLC|Scya21|Scya21b|Tca4|plt
Gene Description chemokine (C-C motif) ligand 21A
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq ADPSDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFSPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRGHHHHHH
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 18829

Enviar uma mensagem


Ccl21a (Mouse) Recombinant Protein

Ccl21a (Mouse) Recombinant Protein