CCL11 (Rhesus Macaque) Recombinant Protein
  • CCL11 (Rhesus Macaque) Recombinant Protein

CCL11 (Rhesus Macaque) Recombinant Protein

Ref: AB-P9443
CCL11 (Rhesus Macaque) Recombinant Protein

Información del producto

Rhesus Macaque CCL11 (Q8MIT7, 24 a.a. - 97 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CCL11
Gene Alias Eotaxin|SCYA11
Gene Description chemokine (C-C motif) ligand 11
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GPDSVATTCCFTLTNKKIPLQRLESYRRIISGKCPQKAVIFKTKLAKDICADPKKKWVQDSMKYLDRKSPTPKP
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 574218

Enviar uma mensagem


CCL11 (Rhesus Macaque) Recombinant Protein

CCL11 (Rhesus Macaque) Recombinant Protein