CXCL16 (Human) Recombinant Protein
  • CXCL16 (Human) Recombinant Protein

CXCL16 (Human) Recombinant Protein

Ref: AB-P9430
CXCL16 (Human) Recombinant Protein

Información del producto

Human CXCL16 (Q9H2A7, 30 a.a. - 118 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name CXCL16
Gene Alias CXCLG16|SR-PSOX|SRPSOX
Gene Description chemokine (C-X-C motif) ligand 16
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq NEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLP
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 58191

Enviar uma mensagem


CXCL16 (Human) Recombinant Protein

CXCL16 (Human) Recombinant Protein