CCL27 (Human) Recombinant Protein
  • CCL27 (Human) Recombinant Protein

CCL27 (Human) Recombinant Protein

Ref: AB-P9428
CCL27 (Human) Recombinant Protein

Información del producto

Human CCL27 (Q9Y4X3, 25 a.a. - 112 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CCL27
Gene Alias ALP|CTACK|CTAK|ESKINE|ILC|PESKY|SCYA27
Gene Description chemokine (C-C motif) ligand 27
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 10mM sodium citrate pH 3.5 (10% glycerol)
Gene ID 10850

Enviar uma mensagem


CCL27 (Human) Recombinant Protein

CCL27 (Human) Recombinant Protein