CCL16 (Human) Recombinant Protein
  • CCL16 (Human) Recombinant Protein

CCL16 (Human) Recombinant Protein

Ref: AB-P9425
CCL16 (Human) Recombinant Protein

Información del producto

Human CCL16 (O15467, 24 a.a. - 120 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CCL16
Gene Alias CKb12|HCC-4|ILINCK|LCC-1|LEC|LMC|MGC117051|Mtn-1|NCC-4|NCC4|SCYA16|SCYL4
Gene Description chemokine (C-C motif) ligand 16
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 6360

Enviar uma mensagem


CCL16 (Human) Recombinant Protein

CCL16 (Human) Recombinant Protein