Ccl6 (Mouse) Recombinant Protein
  • Ccl6 (Mouse) Recombinant Protein

Ccl6 (Mouse) Recombinant Protein

Ref: AB-P9423
Ccl6 (Mouse) Recombinant Protein

Información del producto

Mouse Ccl6 (P27784, 22 a.a. - 116 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name Ccl6
Gene Alias MRP-1|Scya6|c10
Gene Description chemokine (C-C motif) ligand 6
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GLIQEIEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 20305

Enviar uma mensagem


Ccl6 (Mouse) Recombinant Protein

Ccl6 (Mouse) Recombinant Protein