CXCL14 (Human) Recombinant Protein
  • CXCL14 (Human) Recombinant Protein

CXCL14 (Human) Recombinant Protein

Ref: AB-P9419
CXCL14 (Human) Recombinant Protein

Información del producto

Human CXCL14 (O95715, 35 a.a. - 111 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 5 ug
Gene Name CXCL14
Gene Alias BMAC|BRAK|KS1|Kec|MGC10687|MIP-2g|NJAC|SCYB14|bolekine
Gene Description chemokine (C-X-C motif) ligand 14
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MKHHHHHHASSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 9547

Enviar uma mensagem


CXCL14 (Human) Recombinant Protein

CXCL14 (Human) Recombinant Protein