SFTPB (Human) Recombinant Protein
  • SFTPB (Human) Recombinant Protein

SFTPB (Human) Recombinant Protein

Ref: AB-P9409
SFTPB (Human) Recombinant Protein

Información del producto

Human SFTPB (P07988, 25 a.a. - 381 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.
Información adicional
Size 2 x 10 ug
Gene Name SFTPB
Gene Alias PSP-B|SFTB3|SFTP3|SMDP1|SP-B
Gene Description surfactant protein B
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq WTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water
Gene ID 6439

Enviar uma mensagem


SFTPB (Human) Recombinant Protein

SFTPB (Human) Recombinant Protein