SFTPB (Human) Recombinant Protein View larger

Human SFTPB (P07988, 25 a.a. - 381 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.

AB-P9409

New product

SFTPB (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 2 x 10 ug
Gene Name SFTPB
Gene Alias PSP-B|SFTB3|SFTP3|SMDP1|SP-B
Gene Description surfactant protein B
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq WTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water
Gene ID 6439

More info

Human SFTPB (P07988, 25 a.a. - 381 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.

Enviar uma mensagem

Human SFTPB (P07988, 25 a.a. - 381 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.

Human SFTPB (P07988, 25 a.a. - 381 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.