Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
PDGFRB (Human) Recombinant Protein
Abnova
PDGFRB (Human) Recombinant Protein
Ref: AB-P9407
PDGFRB (Human) Recombinant Protein
Contacte-nos
Información del producto
Human PDGFRB (P09619, 33 a.a. - 532 a.a.) partial recombinant protein with hIgG-His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size
2 x 10 ug
Gene Name
PDGFRB
Gene Alias
CD140B|JTK12|PDGF-R-beta|PDGFR|PDGFR1
Gene Description
platelet-derived growth factor receptor, beta polypeptide
Storage Conditions
Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key
SDS-PAGE
Immunogen Prot. Seq
LVVTPPGPELVLNVSSTFVLTCSGSAPVVWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFVPDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVALPVPYDHQRGFSGIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGNEVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSG
Form
Liquid
Recomended Dilution
Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer
In PBS pH 7.4 (10% glycerol)
Gene ID
5159
Enviar uma mensagem
PDGFRB (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*