CDH2 (Human) Recombinant Protein
  • CDH2 (Human) Recombinant Protein

CDH2 (Human) Recombinant Protein

Ref: AB-P9366
CDH2 (Human) Recombinant Protein

Información del producto

Human CDH2 partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.
Información adicional
Size 2 x 10 ug
Gene Name CDH2
Gene Alias CD325|CDHN|CDw325|NCAD
Gene Description cadherin 2, type 1, N-cadherin (neuronal)
Storage Conditions Store at 4C for one weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq ADPDWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDREQIARFHLRAHAVDINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGTVPEGSKPGTYVMTVTAIDADDPNALNGMLRYRIVSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTYGLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDIIVANLTVTDKDQP
Form Liquid
Antigen species Target species Human
Storage Buffer Solution (0.5 mg/mL) containing 1X PBS, pH 7.4, 20% glycerol.
Gene ID 1000

Enviar uma mensagem


CDH2 (Human) Recombinant Protein

CDH2 (Human) Recombinant Protein