CD300E (Human) Recombinant Protein
  • CD300E (Human) Recombinant Protein

CD300E (Human) Recombinant Protein

Ref: AB-P9355
CD300E (Human) Recombinant Protein

Información del producto

Human CD300E partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CD300E
Gene Alias CD300LE|CLM2|IREM2
Gene Description CD300e molecule
Storage Conditions Store at 4C for one weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSLKGPGSVTGTAGDSLTVWCQYESMYKGYNKYWCRGQYDTSCESIVETKGEEKVERNGRVSIRDHPEALAFTVTMQNLNEDDAGSYWCKIQTVWVLDSWSRDPSDLVRVYVSPAITTPRRTTHPATPPIFLVVNPGRNLSTGEVLTQNSGFRLSSPH
Form Liquid
Antigen species Target species Human
Storage Buffer Solution (1 mg/mL) containing 20 mM Tris-HCl, pH 8.0.
Gene ID 342510

Enviar uma mensagem


CD300E (Human) Recombinant Protein

CD300E (Human) Recombinant Protein