CD207 (Human) Recombinant Protein
  • CD207 (Human) Recombinant Protein

CD207 (Human) Recombinant Protein

Ref: AB-P9352
CD207 (Human) Recombinant Protein

Información del producto

Human CD207 partial recombinant protein with His tag in C-terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name CD207
Gene Alias CLEC4K
Gene Description CD207 molecule, langerin
Storage Conditions Store at 4C for one weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq ADPPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFL
Form Liquid
Antigen species Target species Human
Storage Buffer Solution (1 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol.
Gene ID 50489

Enviar uma mensagem


CD207 (Human) Recombinant Protein

CD207 (Human) Recombinant Protein