Cd200r1 (Mouse) Recombinant Protein
  • Cd200r1 (Mouse) Recombinant Protein

Cd200r1 (Mouse) Recombinant Protein

Ref: AB-P9350
Cd200r1 (Mouse) Recombinant Protein

Información del producto

Mouse Cd200r1 partial recombinant proteind with hIgG-His tag in C-terminus expressed in Insect Cells.
Información adicional
Size 2 x 10 ug
Gene Name Cd200r1
Gene Alias CD200R|Mox2r|OX2R
Gene Description CD200 receptor 1
Storage Conditions Store at 4C for one weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq ADPTDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIELSRGGNQSLRPLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMI
Form Liquid
Antigen species Target species Mouse
Storage Buffer Solution (0.5 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol.
Gene ID 57781

Enviar uma mensagem


Cd200r1 (Mouse) Recombinant Protein

Cd200r1 (Mouse) Recombinant Protein