View larger
Human NAMPT recombinant protein expressed in <i>Escherichia coli</i>.
AB-P9330
New product
NAMPT (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 25 ug |
| Gene Name | NAMPT |
| Gene Alias | 1110035O14Rik|DKFZp666B131|MGC117256|PBEF|PBEF1|VF|VISFATIN |
| Gene Description | nicotinamide phosphoribosyltransferase |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
| Immunogen Prot. Seq | MPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYLKGKVVTKEKIQEAKDVYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDS |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Protein was lyophilized with no additives. Reconstitute the lyophilized powder in 20 mM HCl to 0.1 mg/mL. |
| Gene ID | 10135 |
More info
Human NAMPT recombinant protein expressed in Escherichia coli.