NAMPT (Human) Recombinant Protein
  • NAMPT (Human) Recombinant Protein

NAMPT (Human) Recombinant Protein

Ref: AB-P9330
NAMPT (Human) Recombinant Protein

Información del producto

Human NAMPT recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name NAMPT
Gene Alias 1110035O14Rik|DKFZp666B131|MGC117256|PBEF|PBEF1|VF|VISFATIN
Gene Description nicotinamide phosphoribosyltransferase
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key Func
Immunogen Prot. Seq MPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYLKGKVVTKEKIQEAKDVYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDS
Form Lyophilized
Antigen species Target species Human
Storage Buffer Protein was lyophilized with no additives. Reconstitute the lyophilized powder in 20 mM HCl to 0.1 mg/mL.
Gene ID 10135

Enviar uma mensagem


NAMPT (Human) Recombinant Protein

NAMPT (Human) Recombinant Protein