Vegfa (Rat) Recombinant Protein
  • Vegfa (Rat) Recombinant Protein

Vegfa (Rat) Recombinant Protein

Ref: AB-P9319
Vegfa (Rat) Recombinant Protein

Información del producto

Rat Vegfa recombinant protein in?Saccharomyces cerevisiae.
Información adicional
Size 100 ug
Gene Name Vegfa
Gene Alias VEGF164|Vegf
Gene Description vascular endothelial growth factor A
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C for long term storage.
Avoid repeated freeze/thaw cycles.
Application Key Func
Immunogen Prot. Seq MAPTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR
Form Lyophilized
Antigen species Target species Rat
Storage Buffer Lyophilized from 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 83785

Enviar uma mensagem


Vegfa (Rat) Recombinant Protein

Vegfa (Rat) Recombinant Protein