VEGFA (Human) Recombinant Protein
  • VEGFA (Human) Recombinant Protein

VEGFA (Human) Recombinant Protein

Ref: AB-P9301
VEGFA (Human) Recombinant Protein

Información del producto

Human VEGFA partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name VEGFA
Gene Alias MGC70609|VEGF|VEGF-A|VPF
Gene Description vascular endothelial growth factor A
Storage Conditions Store at 4C for one weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Form Liquid
Antigen species Target species Human
Storage Buffer Solution (0.5 mg/mL) containing 20 mM Tris-HCl, pH 8.5, 50% glycerol, 200 mM NaCl, 5 mM DTT, 2 mM EDTA.
Gene ID 7422

Enviar uma mensagem


VEGFA (Human) Recombinant Protein

VEGFA (Human) Recombinant Protein