SERPINA12 (Human) Recombinant Protein
  • SERPINA12 (Human) Recombinant Protein

SERPINA12 (Human) Recombinant Protein

Ref: AB-P9299
SERPINA12 (Human) Recombinant Protein

Información del producto

Human SERPINA12 recombinant proteind with His tag expressed in Escherichia coli.
Información adicional
Size 25 ug
Storage Conditions Store at 10C for 1 week, and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). (0.1% HSA or BSA).Please prevent freeze-thaw cycles
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMLKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDK
Form Liquid
Antigen species Target species Human
Storage Buffer Solution containing 20 mM Tris-HCl, pH 8.0, 10% glycerol,0.2 mM PMSF.
Gene ID 145246

Enviar uma mensagem


SERPINA12 (Human) Recombinant Protein

SERPINA12 (Human) Recombinant Protein