SERPINA12 (Human) Recombinant Protein View larger

Human SERPINA12 recombinant proteind expressed in <i>Escherichia coli</i>.

AB-P9298

New product

SERPINA12 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 25 ug
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. <br>Avoid repeated freeze/thaw cycles.
Immunogen Prot. Seq LKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILP
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from a solution containing 20 mM Tris-HCl, pH 8.0, 0.02% Tween 20, 150 mM NaCl. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL.
Gene ID 145246

More info

Human SERPINA12 recombinant proteind expressed in Escherichia coli.

Enviar uma mensagem

Human SERPINA12 recombinant proteind expressed in <i>Escherichia coli</i>.

Human SERPINA12 recombinant proteind expressed in <i>Escherichia coli</i>.