ULBP1 (Human) Recombinant Protein
  • ULBP1 (Human) Recombinant Protein

ULBP1 (Human) Recombinant Protein

Ref: AB-P9297
ULBP1 (Human) Recombinant Protein

Información del producto

Human ULBP1 partial recombinant proteind with hIgG-His tag in C-terminus expressed in Baculovirus cells.
Información adicional
Size 2 x 10 ug
Gene Name ULBP1
Gene Alias RAET1I
Gene Description UL16 binding protein 1
Storage Conditions Store at 4C for one weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq ADLGWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPGHHHHHH
Form Liquid
Antigen species Target species Human
Storage Buffer Solution (0.5 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol.
Gene ID 80329

Enviar uma mensagem


ULBP1 (Human) Recombinant Protein

ULBP1 (Human) Recombinant Protein