TNFRSF12A (Human) Recombinant Protein
  • TNFRSF12A (Human) Recombinant Protein

TNFRSF12A (Human) Recombinant Protein

Ref: AB-P9268
TNFRSF12A (Human) Recombinant Protein

Información del producto

Human TNFRSF12A partial recombinant protein with hIgG-His tag in C-terminus expressed in Baculovirus cells.
Información adicional
Size 2 x 10 ug
Gene Name TNFRSF12A
Gene Alias CD266|FN14|TWEAKR
Gene Description tumor necrosis factor receptor superfamily, member 12A
Storage Conditions Store at 4C for one weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
Form Liquid
Antigen species Target species Human
Storage Buffer Solution (1 mg/mL) containing 1X PBS, pH 7.4, 20% glycerol, 1mM DTT.
Gene ID 51330

Enviar uma mensagem


TNFRSF12A (Human) Recombinant Protein

TNFRSF12A (Human) Recombinant Protein