TNFSF12 (Human) Recombinant Protein
  • TNFSF12 (Human) Recombinant Protein

TNFSF12 (Human) Recombinant Protein

Ref: AB-P9266
TNFSF12 (Human) Recombinant Protein

Información del producto

Human TNFSF12 partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name TNFSF12
Gene Alias APO3L|DR3LG|MGC129581|MGC20669|TWEAK
Gene Description tumor necrosis factor (ligand) superfamily, member 12
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key Func
Immunogen Prot. Seq MHHHHHHRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 1X PBS. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 8742

Enviar uma mensagem


TNFSF12 (Human) Recombinant Protein

TNFSF12 (Human) Recombinant Protein