TNFRSF10B (Human) Recombinant Protein View larger

Human TNFRSF10B recombinant protein expressed in <i>Escherichia coli</i>.

AB-P9262

New product

TNFRSF10B (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 50 ug
Gene Name TNFRSF10B
Gene Alias CD262|DR5|KILLER|KILLER/DR5|TRAIL-R2|TRAILR2|TRICK2|TRICK2A|TRICK2B|TRICKB|ZTNFR9
Gene Description tumor necrosis factor receptor superfamily, member 10b
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe
Immunogen Prot. Seq ESALITQQDLAPQQRVAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKES
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL.
Gene ID 8795

More info

Human TNFRSF10B recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Human TNFRSF10B recombinant protein expressed in <i>Escherichia coli</i>.

Human TNFRSF10B recombinant protein expressed in <i>Escherichia coli</i>.