TNFSF8 (Human) Recombinant Protein
  • TNFSF8 (Human) Recombinant Protein

TNFSF8 (Human) Recombinant Protein

Ref: AB-P9256
TNFSF8 (Human) Recombinant Protein

Información del producto

Human TNFSF8 partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.
Información adicional
Size 5 ug
Gene Name TNFSF8
Gene Alias CD153|CD30L|CD30LG|MGC138144
Gene Description tumor necrosis factor (ligand) superfamily, member 8
Storage Conditions Store at 4C for one weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq ADPQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSDHHHHHH
Form Liquid
Antigen species Target species Human
Storage Buffer Solution (0.5 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol.
Gene ID 944

Enviar uma mensagem


TNFSF8 (Human) Recombinant Protein

TNFSF8 (Human) Recombinant Protein