View larger
Human TNFAIP8 full-length recombinant protein with His tag in N-terminus expressed in <i>Escherichia coli</i>.
AB-P9235
New product
TNFAIP8 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | TNFAIP8 |
| Gene Alias | GG2-1|MDC-3.13|SCC-S2|SCCS2 |
| Gene Description | tumor necrosis factor, alpha-induced protein 8 |
| Storage Conditions | Store at 4ºC for one weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSMHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution (0.25 mg/mL) containing 20 mM Tris-HCl, pH 8.0, 10% glycerol, 0.15 M NaCl, 1 mM DTT. |
| Gene ID | 25816 |
More info
Human TNFAIP8 full-length recombinant protein with His tag in N-terminus expressed in Escherichia coli.