TGFA (Human) Recombinant Protein
  • TGFA (Human) Recombinant Protein

TGFA (Human) Recombinant Protein

Ref: AB-P9201
TGFA (Human) Recombinant Protein

Información del producto

Human TGFA partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name TGFA
Gene Alias TFGA
Gene Description transforming growth factor, alpha
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Specificity TGFA Human
Application Key Func
Immunogen Prot. Seq VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from a solution containing 0.1% TFA. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 7039

Enviar uma mensagem


TGFA (Human) Recombinant Protein

TGFA (Human) Recombinant Protein