TFF1 (Human) Recombinant Protein
  • TFF1 (Human) Recombinant Protein

TFF1 (Human) Recombinant Protein

Ref: AB-P9194
TFF1 (Human) Recombinant Protein

Información del producto

Human TFF1 recombinant proteind expressed in Escherichia coli..
Información adicional
Size 20 ug
Gene Name TFF1
Gene Alias BCEI|D21S21|HP1.A|HPS2|pNR-2|pS2
Gene Description trefoil factor 1
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Specificity TFF1 Human
Application Key Func
Immunogen Prot. Seq EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from a solution containing 20 mM PB, pH 7.4, 150 mM NaCl. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 7031

Enviar uma mensagem


TFF1 (Human) Recombinant Protein

TFF1 (Human) Recombinant Protein