SPP1 (Human) Recombinant Protein
  • SPP1 (Human) Recombinant Protein

SPP1 (Human) Recombinant Protein

Ref: AB-P9186
SPP1 (Human) Recombinant Protein

Información del producto

Human SPP1 partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name SPP1
Gene Alias BNSP|BSPI|ETA-1|MGC110940|OPN
Gene Description secreted phosphoprotein 1
Storage Conditions Store at 4C for 2-4 weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Specificity SPP1 Human
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHRSMIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKR
Form Liquid
Antigen species Target species Human
Storage Buffer Solution containing 20 mM Tris-HCl, pH 7.5, 10% glycerol, 2 mM EDTA, 1 mM DTT.
Gene ID 6696

Enviar uma mensagem


SPP1 (Human) Recombinant Protein

SPP1 (Human) Recombinant Protein