KITLG (Canine ) Recombinant Protein
  • KITLG (Canine ) Recombinant Protein

KITLG (Canine ) Recombinant Protein

Ref: AB-P9183
KITLG (Canine ) Recombinant Protein

Información del producto

Canine KITLG recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name KITLG
Gene Alias 710-712|CSF|MGF
Gene Description KIT ligand
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Specificity SCF Canine
Application Key Func
Immunogen Prot. Seq KGICGKRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECTEGYSFENVKKAPKSPELRLFTPEEFFRIFNRSIDAFKDLETVASKSSECVVSSTLSPDKDSRVSVTKPFMLPPVA
Form Lyophilized
Antigen species Target species Dog
Storage Buffer Lyophilized from a solution containing 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 403507

Enviar uma mensagem


KITLG (Canine ) Recombinant Protein

KITLG (Canine ) Recombinant Protein