Kitl (Mouse) Recombinant Protein
  • Kitl (Mouse) Recombinant Protein

Kitl (Mouse) Recombinant Protein

Ref: AB-P9179
Kitl (Mouse) Recombinant Protein

Información del producto

Mouse Kitl recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name Kitl
Gene Alias Clo|Con|Gb|Kitlg|Mgf|SCF|SF|SLF|Sl|Steel|contrasted
Gene Description kit ligand
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key Func
Immunogen Prot. Seq MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Protein (1 mg/mL) was lyophilized from a solution containing 0.02% NaHCO3. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 17311

Enviar uma mensagem


Kitl (Mouse) Recombinant Protein

Kitl (Mouse) Recombinant Protein