SAA1 (Human) Recombinant Protein
  • SAA1 (Human) Recombinant Protein

SAA1 (Human) Recombinant Protein

Ref: AB-P9174
SAA1 (Human) Recombinant Protein

Información del producto

Human SAA1 recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name SAA1
Gene Alias MGC111216|PIG4|SAA|TP53I4
Gene Description serum amyloid A1
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key Func
Immunogen Prot. Seq RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from a solution containing 20 mM Tris-HCl, pH 9.0, 150 mM NaCl. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 6288

Enviar uma mensagem


SAA1 (Human) Recombinant Protein

SAA1 (Human) Recombinant Protein