SAA1 (Human) Recombinant Protein View larger

Human SAA1 recombinant protein expressed in <i>Escherichia coli</i>.

AB-P9173

New product

SAA1 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 50 ug
Gene Name SAA1
Gene Alias MGC111216|PIG4|SAA|TP53I4
Gene Description serum amyloid A1
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. <br>Avoid repeated freeze/thaw cycles.
Immunogen Prot. Seq RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISNARENIQRFFGRGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Form Lyophilized
Antigen species Target species Human
Storage Buffer Protein (1 mg/mL) was lyophilized from a solution containing 20 mM Tris-HCl, pH 9.0,150 mM NaCl. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL.
Gene ID 6288

More info

Human SAA1 recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Human SAA1 recombinant protein expressed in <i>Escherichia coli</i>.

Human SAA1 recombinant protein expressed in <i>Escherichia coli</i>.