RBP4 (Human) Recombinant Protein
  • RBP4 (Human) Recombinant Protein

RBP4 (Human) Recombinant Protein

Ref: AB-P9168
RBP4 (Human) Recombinant Protein

Información del producto

Human RBP4 partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name RBP4
Gene Alias -
Gene Description retinol binding protein 4, plasma
Storage Conditions Store at 4C for 2-4 weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Form Liquid
Antigen species Target species Human
Storage Buffer Solution (1 mg/mL) containing 1X PBS, pH 7.4.
Gene ID 5950

Enviar uma mensagem


RBP4 (Human) Recombinant Protein

RBP4 (Human) Recombinant Protein