RBP2 (Human) Recombinant Protein View larger

Human RBP2 full-length recombinant protein with His tag in N-terminus expressed in <i>Escherichia coli</i>.

AB-P9166

New product

RBP2 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 20 ug
Gene Name RBP2
Gene Alias CRABP-II|CRBP2|CRBPII|RBPC2
Gene Description retinol binding protein 2, cellular
Storage Conditions Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles.
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK
Form Liquid
Antigen species Target species Human
Storage Buffer Solution (1 mg/mL) containing 20 mM Tris-HCl, pH 8.0, 10% glycerol, 0.1 M NaCl.
Gene ID 5948

More info

Human RBP2 full-length recombinant protein with His tag in N-terminus expressed in Escherichia coli.

Enviar uma mensagem

Human RBP2 full-length recombinant protein with His tag in N-terminus expressed in <i>Escherichia coli</i>.

Human RBP2 full-length recombinant protein with His tag in N-terminus expressed in <i>Escherichia coli</i>.