RELT (Human) Recombinant Protein
  • RELT (Human) Recombinant Protein

RELT (Human) Recombinant Protein

Ref: AB-P9155
RELT (Human) Recombinant Protein

Información del producto

Human RELT partial recombinant protein with hIgG-His tag in C-terminus expressed in Baculovirus cells.
Información adicional
Size 2 x 10 ug
Gene Name RELT
Gene Alias FLJ14993|TNFRSF19L
Gene Description RELT tumor necrosis factor receptor
Storage Conditions Store at 4C for 2-4 weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRAGGPEETAAQVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPI
Form Liquid
Antigen species Target species Human
Storage Buffer Solution (0.5 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol.
Gene ID 84957
Iso type Sf9, Baculovirus cells.

Enviar uma mensagem


RELT (Human) Recombinant Protein

RELT (Human) Recombinant Protein