AB-P9154
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Size | 25 ug |
Gene Name | Retnlg |
Gene Alias | Fizz3|Relmg|Xcp1 |
Gene Description | resistin like gamma |
Storage Conditions | Lyophilized protein should be stored at -20ºC. Protein aliquots at 4ºC for 2 weeks. <br>Avoid repeated freeze/thaw cycles. |
Immunogen Prot. Seq | MRGSHHHHHHGMASHMTLESIVEKKVKELLANRDDCPSTVTKTFSCTSITASGRLASCPSGMTVTGCACGYGCGSWDIRDGNTCHCQCSTMDWATARCCQLA |
Form | Lyophilized |
Antigen species Target species | Mouse |
Storage Buffer | Protein (0.5 mg/mL) was lyophilized from a solution containing 0.05 M Acetate buffer,pH 4.0. Reconstitute the lyophilized powder in 0.1 M Acetate buffer, pH 4 to 0.5mg/mL, and is not sterile! Please filter the product by an sterile filter before use. In h |
Gene ID | 245195 |
Iso type | Escherichia Coli. |