Tnfsf11 (Mouse) Recombinant Protein
  • Tnfsf11 (Mouse) Recombinant Protein

Tnfsf11 (Mouse) Recombinant Protein

Ref: AB-P9147
Tnfsf11 (Mouse) Recombinant Protein

Información del producto

Mouse Tnfsf11 partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name Tnfsf11
Gene Alias Ly109l|ODF|OPG|OPGL|RANKL|Trance
Gene Description tumor necrosis factor (ligand) superfamily, member 11
Storage Conditions Store at 4C for 2-4 weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key Func
Immunogen Prot. Seq MKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
Form Liquid
Antigen species Target species Mouse
Storage Buffer Solution (1 mg/mL) containing Tris-HCl, pH 8.5, 0.1 M NaCl.
Gene ID 21943
Iso type Escherichia Coli.

Enviar uma mensagem


Tnfsf11 (Mouse) Recombinant Protein

Tnfsf11 (Mouse) Recombinant Protein