TNFSF11 (Human) Recombinant Protein
  • TNFSF11 (Human) Recombinant Protein

TNFSF11 (Human) Recombinant Protein

Ref: AB-P9143
TNFSF11 (Human) Recombinant Protein

Información del producto

Human TNFSF11 recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name TNFSF11
Gene Alias CD254|ODF|OPGL|OPTB2|RANKL|TRANCE|hRANKL2|sOdf
Gene Description tumor necrosis factor (ligand) superfamily, member 11
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key Func
Immunogen Prot. Seq EKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
Form Lyophilized
Antigen species Target species Human
Storage Buffer Protein(1 mg/mL) was lyophilized from a solution containing 10 mM Sodium phosphate, pH 7.5. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 8600
Iso type Escherichia Coli.

Enviar uma mensagem


TNFSF11 (Human) Recombinant Protein

TNFSF11 (Human) Recombinant Protein