View larger
Mouse Dhh recombinant protein expressed in <i>Escherichia coli</i>.
AB-P9139
New product
Dhh (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 25 ug |
| Gene Name | Dhh |
| Gene Alias | C78960|MGC73610 |
| Gene Description | desert hedgehog |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
| Immunogen Prot. Seq | IIGPGRGPVGRRRYVRKQLVPLLYKQFVPSMPERTLGASGPAEGRVTRGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHIHVSVKADNSLAVRAGG |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Storage Buffer | Lyophilized from a solution containing IX PBS, pH7.4, 1 mM DTT, 0.05% Tween 80. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
| Gene ID | 13363 |
| Iso type | Escherichia Coli. |
More info
Mouse Dhh recombinant protein expressed in Escherichia coli.