Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
CD80 (Human) Recombinant Protein
Abnova
CD80 (Human) Recombinant Protein
Ref: AB-P9108
CD80 (Human) Recombinant Protein
Contacte-nos
Información del producto
Human CD80 (P33681, 35 a.a. - 242 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in
Baculovirus
.
Información adicional
Size
5 ug
Gene Name
CD80
Gene Alias
CD28LG|CD28LG1|LAB7
Gene Description
CD80 molecule
Storage Conditions
Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key
SDS-PAGE
Immunogen Prot. Seq
VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNLEHHHHHH.
Form
Liquid
Antigen species Target species
Human
Storage Buffer
PBS (pH7.4) and 10% glycerol.
Gene ID
941
Enviar uma mensagem
CD80 (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*