View larger
Human CD69 (Q07108, 62 a.a. - 199 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in <i>Baculoviru
AB-P9101
New product
CD69 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | CD69 |
| Gene Alias | CLEC2C |
| Gene Description | CD69 molecule |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | ADPSVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYKHHHHHH. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | PBS (pH7.4) and 10% glycerol. |
| Gene ID | 969 |
More info
Human CD69 (Q07108, 62 a.a. - 199 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in Baculovirus.