Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
CD69 (Human) Recombinant Protein
Abnova
CD69 (Human) Recombinant Protein
Ref: AB-P9101
CD69 (Human) Recombinant Protein
Contacte-nos
Información del producto
Human CD69 (Q07108, 62 a.a. - 199 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in
Baculovirus
.
Información adicional
Size
2 x 10 ug
Gene Name
CD69
Gene Alias
CLEC2C
Gene Description
CD69 molecule
Storage Conditions
Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key
SDS-PAGE
Immunogen Prot. Seq
ADPSVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYKHHHHHH.
Form
Liquid
Antigen species Target species
Human
Storage Buffer
PBS (pH7.4) and 10% glycerol.
Gene ID
969
Enviar uma mensagem
CD69 (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*