Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
Cd55 (Mouse) Recombinant Protein
Abnova
Cd55 (Mouse) Recombinant Protein
Ref: AB-P9093
Cd55 (Mouse) Recombinant Protein
Contacte-nos
Información del producto
Mouse Cd55 (Q61475, 35 a.a. - 362 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in
Baculovirus
.
Información adicional
Size
2 x 10 ug
Gene Name
Cd55
Gene Alias
Daf|Daf-GPI|Daf1|GPI-DAF
Gene Description
CD55 antigen
Storage Conditions
Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key
SDS-PAGE
Immunogen Prot. Seq
DCGPPPDIPNARPILGRHSKFAEQSKVAYSCNNGFKQVPDKSNIVVCLENGQWSSHETFCEKSCVAPERLSFASLKKEYLNMNFFPVGTIVEYECRPGFRKQPPLPGKATCLEDLVWSPVAQFCKKKSCPNPKDLDNGHINIPTGILFGSEINFSCNPGYRLVGVSSTFCSVTGNTVDWDDEFPVCTEIHCPEPPKINNGIMRGESDSYTYSQVVTYSCDKGFILVGNASIYCTVSKSDVGQWSSPPPRCIEKSK
Form
Liquid
Antigen species Target species
Mouse
Storage Buffer
PBS (pH7.4) and 10% glycerol.
Gene ID
13136
Enviar uma mensagem
Cd55 (Mouse) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*