CD48 (Human) Recombinant Protein
  • CD48 (Human) Recombinant Protein

CD48 (Human) Recombinant Protein

Ref: AB-P9090
CD48 (Human) Recombinant Protein

Información del producto

Human CD48 (P09326, 27 a.a. - 220 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in Baculovirus.
Información adicional
Size 2 x 10 ug
Gene Name CD48
Gene Alias BCM1|BLAST|BLAST1|MEM-102|SLAMF2|hCD48|mCD48
Gene Description CD48 molecule
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq ADPQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSHHHHHH.
Form Liquid
Antigen species Target species Human
Storage Buffer PBS (pH7.4) and 10% glycerol.
Gene ID 962

Enviar uma mensagem


CD48 (Human) Recombinant Protein

CD48 (Human) Recombinant Protein