Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
CD46 (Human) Recombinant Protein
Abnova
CD46 (Human) Recombinant Protein
Ref: AB-P9088
CD46 (Human) Recombinant Protein
Contacte-nos
Información del producto
Human CD46 (P15529, 35 a.a. - 313 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in
Escherichia coli
.
Información adicional
Size
20 ug
Gene Name
CD46
Gene Alias
MCP|MGC26544|MIC10|TLX|TRA2.10
Gene Description
CD46 molecule, complement regulatory protein
Storage Conditions
Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key
SDS-PAGE
Immunogen Prot. Seq
MGSSHHHHHHSSGLVPRGSHMGSCEEPPTFEAMELIGKPKPYYEIGERVDYKCKKGYFYIPPLATHTICDRNHTWLPVSDDACYRETCPYIRDPLNGQAVPANGTYEFGYQMHFICNEGYYLIGEEILYCELKGSVAIWSGKPPICEKVLCTPPPKIKNGKHTFSEVEVFEYLDAVTYSCDPAPGPDPFSLIGESTIYCGDNSVWSRAAPECKVVKCRFPVVENGKQISGFGKKFYYKATVMFECDKGFYLDGSD
Form
Liquid
Antigen species Target species
Human
Storage Buffer
20mM Tris-HCl buffer (pH 8.0), 0.1M NaCl and 20% glycerol.
Gene ID
4179
Enviar uma mensagem
CD46 (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*