View larger
Human SPN (P16150, 20 a.a. - 253 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in <i>Escherichia
AB-P9087
New product
SPN (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | SPN |
| Gene Alias | CD43|GPL115|LSN |
| Gene Description | sialophorin |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDEN |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | 20mM Tris-HCl buffer (pH 8.0), 0.15M NaCl and 10% glycerol. |
| Gene ID | 6693 |
More info
Human SPN (P16150, 20 a.a. - 253 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.