Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
SPN (Human) Recombinant Protein
Abnova
SPN (Human) Recombinant Protein
Ref: AB-P9087
SPN (Human) Recombinant Protein
Contacte-nos
Información del producto
Human SPN (P16150, 20 a.a. - 253 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in
Escherichia coli
.
Información adicional
Size
20 ug
Gene Name
SPN
Gene Alias
CD43|GPL115|LSN
Gene Description
sialophorin
Storage Conditions
Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key
SDS-PAGE
Immunogen Prot. Seq
MGSSHHHHHHSSGLVPRGSHMGSSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDEN
Form
Liquid
Antigen species Target species
Human
Storage Buffer
20mM Tris-HCl buffer (pH 8.0), 0.15M NaCl and 10% glycerol.
Gene ID
6693
Enviar uma mensagem
SPN (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*