Cd40 (Mouse) Recombinant Protein
  • Cd40 (Mouse) Recombinant Protein

Cd40 (Mouse) Recombinant Protein

Ref: AB-P9086
Cd40 (Mouse) Recombinant Protein

Información del producto

Mouse Cd40 (P27512, 20 a.a. - 193 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in Baculovirus.
Información adicional
Size 2 x 10 ug
Gene Name Cd40
Gene Alias AI326936|Bp50|GP39|HIGM1|IGM|IMD3|T-BAM|TRAP|Tnfrsf5|p50
Gene Description CD40 antigen
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq LGQCVTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMRHHHHHH.
Form Liquid
Antigen species Target species Mouse
Storage Buffer PBS (pH7.4) and 10% glycerol.
Gene ID 21939

Enviar uma mensagem


Cd40 (Mouse) Recombinant Protein

Cd40 (Mouse) Recombinant Protein