CD40 (Human) Recombinant Protein View larger

Human CD40 (P25942, 21 a.a. - 193 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in <i>Escherichi

AB-P9084

New product

CD40 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 2 x 10 ug
Gene Name CD40
Gene Alias Bp50|CDW40|MGC9013|TNFRSF5|p50
Gene Description CD40 molecule, TNF receptor superfamily member 5
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
Form Liquid
Antigen species Target species Human
Storage Buffer 20mM Tris-HCl buffer (pH 8.0), 0.15M NaCl, 10% glycerol and 1mM DTT.
Gene ID 958

More info

Human CD40 (P25942, 21 a.a. - 193 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.

Enviar uma mensagem

Human CD40 (P25942, 21 a.a. - 193 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in <i>Escherichi

Human CD40 (P25942, 21 a.a. - 193 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in <i>Escherichi