View larger
Human PGF (P49763, 19 a.a. - 170 a.a.) partial-length recombinant protein expressed in CHO cell.
AB-P9041
New product
PGF (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 25 ug |
| Gene Name | PGF |
| Gene Alias | D12S1900|PGFL|PLGF|PlGF-2|SHGC-10760 |
| Gene Description | placental growth factor |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from HCl. |
| Gene ID | 5228 |
More info
Human PGF (P49763, 19 a.a. - 170 a.a.) partial-length recombinant protein expressed in CHO cell.